SCOPe 2.08: Domain d4sdhb_: 4sdh B:

Lineage for d4sdhb_ (4sdh B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries)

8. Domain d4sdhb_: 4sdh B: [14989]
   complexed with hem

Details for d4sdhb_

PDB Entry: 4sdh, 1.6 Å

PDB Description: high resolution crystallographic analysis of a cooperative dimeric hemoglobin

PDB Compounds: (B:) hemoglobin I (deoxy)

SCOPe Domain Sequences for d4sdhb_:

Sequence; same for both SEQRES and ATOM records:

>d4sdhb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d4sdhb_:

• d4sdhb_ first appeared (with stable ids) in SCOP 1.55
  
• d4sdhb_ appears in SCOPe 2.07