Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.12: TyrA dimerization domain-like [140780] (1 protein) new dimerisation mode with swapping of C-terminal helices |
Protein Prephenate dehydrogenase TyrA [140781] (3 species) |
Species Haemophilus influenzae [TaxId:727] [158736] (1 PDB entry) Uniprot P43902 244-371 |
Domain d2pv7b1: 2pv7 B:244-371 [149889] Other proteins in same PDB: d2pv7a2, d2pv7b2 automated match to d2pv7a1 complexed with nad, tyr |
PDB Entry: 2pv7 (more details), 2 Å
SCOPe Domain Sequences for d2pv7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pv7b1 a.100.1.12 (B:244-371) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} natehdhnmtyiqalrhfstfanglhlskqpinlanllalsspiyrlelamigrlfaqda elyadiimdksenlavietlkqtydealtffenndrqgfidafhkvrdwfgdyseqflke srqllqqa
Timeline for d2pv7b1: