SCOPe 2.08: Domain d2pv7b1: 2pv7 B:244-371

Lineage for d2pv7b1 (2pv7 B:244-371)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.12: TyrA dimerization domain-like [140780] (1 protein)
   new dimerisation mode with swapping of C-terminal helices

6. Protein Prephenate dehydrogenase TyrA [140781] (3 species)

7. Species Haemophilus influenzae [TaxId:727] [158736] (1 PDB entry)
   Uniprot P43902 244-371

8. Domain d2pv7b1: 2pv7 B:244-371 [149889]
   Other proteins in same PDB: d2pv7a2, d2pv7b2
   automated match to d2pv7a1
   complexed with nad, tyr

Details for d2pv7b1

PDB Entry: 2pv7, 2 Å

PDB Description: crystal structure of chorismate mutase / prephenate dehydrogenase (tyra) (1574749) from haemophilus influenzae rd at 2.00 a resolution

PDB Compounds: (B:) T-protein [Includes: Chorismate mutase (EC 5.4.99.5) (CM) and Prephenate dehydrogenase (EC 1.3.1.12) (PDH)]

SCOPe Domain Sequences for d2pv7b1:

Sequence; same for both SEQRES and ATOM records:

>d2pv7b1 a.100.1.12 (B:244-371) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]}
natehdhnmtyiqalrhfstfanglhlskqpinlanllalsspiyrlelamigrlfaqda
elyadiimdksenlavietlkqtydealtffenndrqgfidafhkvrdwfgdyseqflke
srqllqqa

Timeline for d2pv7b1:

• d2pv7b1 first appeared in SCOP 1.75
  
• d2pv7b1 appears in SCOPe 2.07