SCOPe 2.03: Domain d2pv7a2: 2pv7 A:92-243

Lineage for d2pv7a2 (2pv7 A:92-243)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Prephenate dehydrogenase TyrA [141929] (3 species)

7. Species Haemophilus influenzae [TaxId:727] [159425] (1 PDB entry)
   Uniprot P43902 92-243

8. Domain d2pv7a2: 2pv7 A:92-243 [149888]
   Other proteins in same PDB: d2pv7a1, d2pv7b1
   complexed with nad, tyr

Details for d2pv7a2

PDB Entry: 2pv7, 2 Å

PDB Description: crystal structure of chorismate mutase / prephenate dehydrogenase (tyra) (1574749) from haemophilus influenzae rd at 2.00 a resolution

PDB Compounds: (A:) T-protein [Includes: Chorismate mutase (EC 5.4.99.5) (CM) and Prephenate dehydrogenase (EC 1.3.1.12) (PDH)]

SCOPe Domain Sequences for d2pv7a2:

Sequence; same for both SEQRES and ATOM records:

>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]}
gfktinsdihkivivggygklgglfarylrasgypisildredwavaesilanadvvivs
vpinltletierlkpyltenmlladltsvkreplakmlevhtgavlglhpmfgadiasma
kqvvvrcdgrfperyewlleqiqiwgakiyqt

Timeline for d2pv7a2:

• d2pv7a2 first appeared in SCOP 1.75
  
• d2pv7a2 appears in SCOPe 2.02
  
• d2pv7a2 appears in SCOPe 2.04
  
• d2pv7a2 appears in the current release, SCOPe 2.08