Lineage for d2pv4a1 (2pv4 A:1-144)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739200Fold a.286: Sama2622-like [158674] (1 superfamily)
    core: 6 helices; bundle; one central helix is surrounded by 5 others
  4. 2739201Superfamily a.286.1: Sama2622-like [158675] (1 family) (S)
    automatically mapped to Pfam PF11269
  5. 2739202Family a.286.1.1: Sama2622-like [158676] (1 protein)
  6. 2739203Protein Uncharacterized protein Sama2622 [158677] (1 species)
  7. 2739204Species Shewanella amazonensis [TaxId:60478] [158678] (1 PDB entry)
    Uniprot A1S8W8 1-144
  8. 2739205Domain d2pv4a1: 2pv4 A:1-144 [149886]
    Other proteins in same PDB: d2pv4a2
    complexed with gol

Details for d2pv4a1

PDB Entry: 2pv4 (more details), 1.95 Å

PDB Description: crystal structure of an uncharacterized protein from duf3069 family (sama_2622) from shewanella amazonensis sb2b at 1.95 a resolution
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2pv4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pv4a1 a.286.1.1 (A:1-144) Uncharacterized protein Sama2622 {Shewanella amazonensis [TaxId: 60478]}
mseidanyralaqqvadkvagrvialdrlpeslltayrslcdelladrdgrftrawdqlp
dsasslfercvfhgfylanawiqlsivardiselqdtdeaiaeqeysglyvrvaeaalke
svkklkkartdrsmynsmrevmgi

SCOPe Domain Coordinates for d2pv4a1:

Click to download the PDB-style file with coordinates for d2pv4a1.
(The format of our PDB-style files is described here.)

Timeline for d2pv4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pv4a2