![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.286: Sama2622-like [158674] (1 superfamily) core: 6 helices; bundle; one central helix is surrounded by 5 others |
![]() | Superfamily a.286.1: Sama2622-like [158675] (1 family) ![]() automatically mapped to Pfam PF11269 |
![]() | Family a.286.1.1: Sama2622-like [158676] (1 protein) |
![]() | Protein Uncharacterized protein Sama2622 [158677] (1 species) |
![]() | Species Shewanella amazonensis [TaxId:60478] [158678] (1 PDB entry) Uniprot A1S8W8 1-144 |
![]() | Domain d2pv4a1: 2pv4 A:1-144 [149886] Other proteins in same PDB: d2pv4a2 complexed with gol |
PDB Entry: 2pv4 (more details), 1.95 Å
SCOPe Domain Sequences for d2pv4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pv4a1 a.286.1.1 (A:1-144) Uncharacterized protein Sama2622 {Shewanella amazonensis [TaxId: 60478]} mseidanyralaqqvadkvagrvialdrlpeslltayrslcdelladrdgrftrawdqlp dsasslfercvfhgfylanawiqlsivardiselqdtdeaiaeqeysglyvrvaeaalke svkklkkartdrsmynsmrevmgi
Timeline for d2pv4a1: