SCOPe 2.08: Domain d2pv3a1: 2pv3 A:25-163,A:396-427

Lineage for d2pv3a1 (2pv3 A:25-163,A:396-427)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily)
   multihelical; irregular array of long and short helices

4. Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (3 families)
   there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family)

5. Family a.223.1.2: Porin chaperone SurA, peptide-binding domain [81828] (1 protein)

6. Protein Porin chaperone SurA, peptide-binding domain [81829] (1 species)

7. Species Escherichia coli [TaxId:562] [81830] (2 PDB entries)

8. Domain d2pv3a1: 2pv3 A:25-163,A:396-427 [149882]
   Other proteins in same PDB: d2pv3a2, d2pv3b2
   automatically matched to d1m5yd1

Details for d2pv3a1

PDB Entry: 2pv3, 3.39 Å

PDB Description: crystallographic structure of sura fragment lacking the second peptidyl-prolyl isomerase domain complexed with peptide nftlkfwdifrk

PDB Compounds: (A:) Chaperone surA

SCOPe Domain Sequences for d2pv3a1:

Sequence; same for both SEQRES and ATOM records:

>d2pv3a1 a.223.1.2 (A:25-163,A:396-427) Porin chaperone SurA, peptide-binding domain {Escherichia coli [TaxId: 562]}
vdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqiilqmg
qkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiisevrnn
evrrritilpqeveslaqqXrayrmlmnrkfseeaaswmqeqrasayvkils

Timeline for d2pv3a1:

• d2pv3a1 first appeared in SCOP 1.75
  
• d2pv3a1 appears in SCOPe 2.07