Lineage for d2pv2d1 (2pv2 D:172-274)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857507Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 857508Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 857509Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 857645Protein Porin chaperone SurA, PPIase domains [82624] (1 species)
  7. 857646Species Escherichia coli [TaxId:562] [82625] (4 PDB entries)
  8. 857650Domain d2pv2d1: 2pv2 D:172-274 [149881]
    automatically matched to d1m5ya2

Details for d2pv2d1

PDB Entry: 2pv2 (more details), 1.3 Å

PDB Description: crystallographic structure of sura first peptidyl-prolyl isomerase domain complexed with peptide nftlkfwdifrk
PDB Compounds: (D:) Chaperone surA

SCOP Domain Sequences for d2pv2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pv2d1 d.26.1.1 (D:172-274) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]}
telnlshiliplpenptsdqvneaesqaraivdqarngadfgklaiahsadqqalnggqm
gwgriqelpgifaqalstakkgdivgpirsgvgfhilkvndlr

SCOP Domain Coordinates for d2pv2d1:

Click to download the PDB-style file with coordinates for d2pv2d1.
(The format of our PDB-style files is described here.)

Timeline for d2pv2d1: