![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.17: Imidazolonepropionase-like [159400] (3 proteins) automatically mapped to Pfam PF13147 |
![]() | Protein Imidazolonepropionase [159405] (2 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [159407] (2 PDB entries) Uniprot Q8U8Z6 78-378 |
![]() | Domain d2puzb2: 2puz B:80-380 [149876] Other proteins in same PDB: d2puza1, d2puzb1 automated match to d2puza2 complexed with cl, fe, mg, nig |
PDB Entry: 2puz (more details), 1.83 Å
SCOPe Domain Sequences for d2puzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2puzb2 c.1.9.17 (B:80-380) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} palidchthlvfggnramefemrlngatyeeiakagggivssvrdtralsdevlvaqalp rldtllsegvstieiksgygldietelkmlrvarrletlrpvrivtsylaahatpadykg rnadyitdvvlpglekahaegladavdgfcegiafsvkeidrvfaaaqqrglpvklhaeq lsnlggaelaasynalsadhleyldetgakalakagtvavllpgafyalrekqlppvqal rdagaeialatdcnpgtspltsllltmnmgatlfrmtveecltattrnaakalgllaetg t
Timeline for d2puzb2: