![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.10: Imidazolonepropionase-like [159347] (3 proteins) |
![]() | Protein Imidazolonepropionase [159348] (2 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [159350] (2 PDB entries) Uniprot Q8U8Z6 15-77,379-418 |
![]() | Domain d2puzb1: 2puz B:17-79,B:381-420 [149875] Other proteins in same PDB: d2puza2, d2puzb2 automated match to d2puza1 complexed with cl, fe, mg, nig |
PDB Entry: 2puz (more details), 1.83 Å
SCOPe Domain Sequences for d2puzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2puzb1 b.92.1.10 (B:17-79,B:381-420) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} atalwrnaqlatlnpamdgigavenaviavrngriafagpesdlpddlstadettdcggr witXleagksadfaiwdierpaelvyrigfnplharifkgqkvs
Timeline for d2puzb1: