SCOP 1.71: Domain d3hbib_: 3hbi B:

Lineage for d3hbib_ (3hbi B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (17 PDB entries)

8. Domain d3hbib_: 3hbi B: [14987]
   complexed with cmo, hem; mutant

Details for d3hbib_

PDB Entry: 3hbi, 1.5 Å

PDB Description: mutation of residue phe 97 to leu disrupts the central allosteric pathway of scapharca dimeric hemoglobin

SCOP Domain Sequences for d3hbib_:

Sequence; same for both SEQRES and ATOM records:

>d3hbib_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis)}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvveklavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d3hbib_:

• d3hbib_ first appeared (with stable ids) in SCOP 1.55
  
• d3hbib_ appears in SCOP 1.69
  
• d3hbib_ does not appear in SCOP 1.73