Lineage for d2pukf_ (2puk F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783791Family b.34.4.3: Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain [50098] (1 protein)
    automatically mapped to Pfam PF02941
  6. 2783792Protein Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain [50099] (1 species)
  7. 2783793Species Synechocystis sp. [TaxId:1143] [50100] (7 PDB entries)
  8. 2783800Domain d2pukf_: 2puk F: [149864]
    Other proteins in same PDB: d2puka_, d2pukc_, d2puke2, d2puke3, d2pukg_
    automated match to d2pu9b_
    complexed with sf4

Details for d2pukf_

PDB Entry: 2puk (more details), 3 Å

PDB Description: crystal structure of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin m
PDB Compounds: (F:) Ferredoxin-thioredoxin reductase, variable chain

SCOPe Domain Sequences for d2pukf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pukf_ b.34.4.3 (F:) Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain {Synechocystis sp. [TaxId: 1143]}
mnvgdrvrvtssvvvyhhpehkktafdlqgmegevaavltewqgrpisanlpvlvkfeqr
fkahfrpdevtli

SCOPe Domain Coordinates for d2pukf_:

Click to download the PDB-style file with coordinates for d2pukf_.
(The format of our PDB-style files is described here.)

Timeline for d2pukf_: