Class g: Small proteins [56992] (100 folds) |
Fold g.36: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57661] (1 superfamily) folds around 4Fe-4S cluster |
Superfamily g.36.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57662] (1 family) automatically mapped to Pfam PF02943 |
Family g.36.1.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57663] (1 protein) |
Protein Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57664] (2 species) |
Species Synechocystis sp. [TaxId:1143] [57665] (7 PDB entries) |
Domain d2puka_: 2puk A: [149861] Other proteins in same PDB: d2pukb_, d2pukc_, d2puke3, d2pukf_, d2pukg_ automated match to d1dj7a_ complexed with sf4 |
PDB Entry: 2puk (more details), 3 Å
SCOPe Domain Sequences for d2puka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2puka_ g.36.1.1 (A:) Ferredoxin thioredoxin reductase (FTR), catalytic beta chain {Synechocystis sp. [TaxId: 1143]} nktlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeaev kntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleevkas
Timeline for d2puka_: