Lineage for d2pu4b_ (2pu4 B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2618365Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 2618407Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (115 PDB entries)
  8. 2618611Domain d2pu4b_: 2pu4 B: [149853]
    automated match to d1c3ba_
    complexed with dms, ox6, ox7, so4

Details for d2pu4b_

PDB Entry: 2pu4 (more details), 2 Å

PDB Description: ampc beta-lacamase with bound covalent oxadiazole inhibitor
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d2pu4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pu4b_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOPe Domain Coordinates for d2pu4b_:

Click to download the PDB-style file with coordinates for d2pu4b_.
(The format of our PDB-style files is described here.)

Timeline for d2pu4b_: