Lineage for d2pu1a2 (2pu1 A:1-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947634Protein Enolase [54828] (10 species)
  7. 2947728Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [160264] (6 PDB entries)
  8. 2947730Domain d2pu1a2: 2pu1 A:1-138 [149849]
    Other proteins in same PDB: d2pu1a1, d2pu1a3
    automated match to d1oepa2
    complexed with edo, fsg, zn

Details for d2pu1a2

PDB Entry: 2pu1 (more details), 1.8 Å

PDB Description: crystal structure of the t. brucei enolase complexed with fluoro- phosphonoacetohydroxamate (fpah)
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d2pu1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pu1a2 d.54.1.1 (A:1-138) Enolase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mtiqkvhgrevldsrgnptvevevttekgvfrsavpsgastgvyeacelrdgdkkryvgk
gclqavknvnevigpaligrdelkqeeldtlmlrldgtpnkgklganailgcsmaiskaa
aaakgvplyrylaslagt

SCOPe Domain Coordinates for d2pu1a2:

Click to download the PDB-style file with coordinates for d2pu1a2.
(The format of our PDB-style files is described here.)

Timeline for d2pu1a2: