Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
Protein Enolase [51606] (9 species) Fold of this protein slightly differs from common fold in topology |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [159415] (6 PDB entries) |
Domain d2ptxa1: 2ptx A:139-429 [149840] Other proteins in same PDB: d2ptxa2 automatically matched to d1oepa1 complexed with edo, so4, zn |
PDB Entry: 2ptx (more details), 1.9 Å
SCOPe Domain Sequences for d2ptxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ptxa1 c.1.11.1 (A:139-429) Enolase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} kelrlpvpcfnvinggkhagnalpfqefmiapvkatsfsealrmgsevyhslrgiikkky gqdavnvgdeggfappikdineplpilmeaieeaghrgkfaicmdcaasetydekkqqyn ltfkspeptwvtaeqlretyckwahdypivsiedpydqddfagfagitealkgktqivgd dltvtnterikmaiekkacnslllkinqigtiseaiassklcmengwsvmvshrsgeted tyiadlvvalgsgqiktgapcrgertaklnqllrieeelgahakfgfpgws
Timeline for d2ptxa1: