Lineage for d2ptfb_ (2ptf B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055233Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2055420Family b.45.1.4: MTH863-like [159164] (3 protein domains)
    Pfam PF04289; DUF447; a new dimerisation mode involving (included) all-alpha subdomain of the spectrin-like fold (46965)
  6. 2055431Protein Uncharacterized protein MTH863 [159169] (1 species)
  7. 2055432Species Methanobacterium thermoautotrophicum [TaxId:145262] [159170] (1 PDB entry)
    Uniprot O26951 15-220
  8. 2055434Domain d2ptfb_: 2ptf B: [149837]
    automated match to d2ptfa1
    complexed with fmn

Details for d2ptfb_

PDB Entry: 2ptf (more details), 2.35 Å

PDB Description: crystal structure of protein mth_863 from methanobacterium thermoautotrophicum bound to fmn
PDB Compounds: (B:) Uncharacterized protein MTH_863

SCOPe Domain Sequences for d2ptfb_:

Sequence, based on SEQRES records: (download)

>d2ptfb_ b.45.1.4 (B:) Uncharacterized protein MTH863 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
veythfkdlqalemergrlyetivvtwddsmvgnaapigvlctgddtvtlylyqgtrtve
nvlnngrftvnvtldpliftdstlgdleedmfshyrdflhlrgadafftaevvsvkklvk
rdrfgeselhvvkaragdvmraesfrmalnrgiyaviesliaytraefsdplvlreriae
mnrvarkvggprekeamrriiqales

Sequence, based on observed residues (ATOM records): (download)

>d2ptfb_ b.45.1.4 (B:) Uncharacterized protein MTH863 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
veythfkdlqalemergrlyetivvtwddsmvgnaapigvlctgddtvtlylyqgtrtve
nvlnngrftvnvtldpliftdstlgdleedmfshyrdflhlrgadafftaevvsvkklve
selhvvkaragdvmraesfrmalnrgiyaviesliaytraefsdplvlreriaemnrvar
kvggprekeamrriiqales

SCOPe Domain Coordinates for d2ptfb_:

Click to download the PDB-style file with coordinates for d2ptfb_.
(The format of our PDB-style files is described here.)

Timeline for d2ptfb_: