SCOPe 2.08: Domain d2ptfb_: 2ptf B:

Lineage for d2ptfb_ (2ptf B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.4: MTH863-like [159164] (3 proteins)
   Pfam PF04289; DUF447; a new dimerisation mode involving (included) all-alpha subdomain of the spectrin-like fold (46965)

6. Protein Uncharacterized protein MTH863 [159169] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [159170] (1 PDB entry)
   Uniprot O26951 15-220

8. Domain d2ptfb_: 2ptf B: [149837]
   automated match to d2ptfa1
   complexed with fmn

Details for d2ptfb_

PDB Entry: 2ptf, 2.35 Å

PDB Description: crystal structure of protein mth_863 from methanobacterium thermoautotrophicum bound to fmn

PDB Compounds: (B:) Uncharacterized protein MTH_863

SCOPe Domain Sequences for d2ptfb_:

Sequence, based on SEQRES records:

>d2ptfb_ b.45.1.4 (B:) Uncharacterized protein MTH863 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
veythfkdlqalemergrlyetivvtwddsmvgnaapigvlctgddtvtlylyqgtrtve
nvlnngrftvnvtldpliftdstlgdleedmfshyrdflhlrgadafftaevvsvkklvk
rdrfgeselhvvkaragdvmraesfrmalnrgiyaviesliaytraefsdplvlreriae
mnrvarkvggprekeamrriiqales

Sequence, based on observed residues (ATOM records):

>d2ptfb_ b.45.1.4 (B:) Uncharacterized protein MTH863 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
veythfkdlqalemergrlyetivvtwddsmvgnaapigvlctgddtvtlylyqgtrtve
nvlnngrftvnvtldpliftdstlgdleedmfshyrdflhlrgadafftaevvsvkklve
selhvvkaragdvmraesfrmalnrgiyaviesliaytraefsdplvlreriaemnrvar
kvggprekeamrriiqales

Timeline for d2ptfb_:

• d2ptfb_ first appeared in SCOP 1.75, called d2ptfb1
  
• d2ptfb_ appears in SCOPe 2.07