Lineage for d2ptfa1 (2ptf A:15-220)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794341Family b.45.1.4: MTH863-like [159164] (3 proteins)
    Pfam PF04289; DUF447; a new dimerisation mode involving (included) all-alpha subdomain of the spectrin-like fold (46965)
  6. 2794352Protein Uncharacterized protein MTH863 [159169] (1 species)
  7. 2794353Species Methanobacterium thermoautotrophicum [TaxId:145262] [159170] (1 PDB entry)
    Uniprot O26951 15-220
  8. 2794354Domain d2ptfa1: 2ptf A:15-220 [149836]
    complexed with fmn

Details for d2ptfa1

PDB Entry: 2ptf (more details), 2.35 Å

PDB Description: crystal structure of protein mth_863 from methanobacterium thermoautotrophicum bound to fmn
PDB Compounds: (A:) Uncharacterized protein MTH_863

SCOPe Domain Sequences for d2ptfa1:

Sequence, based on SEQRES records: (download)

>d2ptfa1 b.45.1.4 (A:15-220) Uncharacterized protein MTH863 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
veythfkdlqalemergrlyetivvtwddsmvgnaapigvlctgddtvtlylyqgtrtve
nvlnngrftvnvtldpliftdstlgdleedmfshyrdflhlrgadafftaevvsvkklvk
rdrfgeselhvvkaragdvmraesfrmalnrgiyaviesliaytraefsdplvlreriae
mnrvarkvggprekeamrriiqales

Sequence, based on observed residues (ATOM records): (download)

>d2ptfa1 b.45.1.4 (A:15-220) Uncharacterized protein MTH863 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
veythfkdlqalemergrlyetivvtwddsmvgnaapigvlctgddtvtlylyqgtrtve
nvlnngrftvnvtldpliftdstlgdleedmfshyrdflhlrgadafftaevvsvkklvk
rdreselhvvkaragdvmraesfrmalnrgiyaviesliaytraplvlreriaemnrvar
kvggprekeamrriiqales

SCOPe Domain Coordinates for d2ptfa1:

Click to download the PDB-style file with coordinates for d2ptfa1.
(The format of our PDB-style files is described here.)

Timeline for d2ptfa1: