SCOP 1.75: Domain d2pt0b1: 2pt0 B:34-346

Lineage for d2pt0b1 (2pt0 B:34-346)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (1 protein)

6. Protein Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117584] (1 species)

7. Species Selenomonas ruminantium [TaxId:971] [117585] (8 PDB entries)
   Uniprot Q7WUJ1 34-346

8. Domain d2pt0b1: 2pt0 B:34-346 [149833]
   automatically matched to d1u24a_
   complexed with gol

Details for d2pt0b1

PDB Entry: 2pt0, 1.7 Å

PDB Description: Structure of Selenomonas ruminantium PTP-like phytase with the active site cysteine oxidized to cysteine-sulfonic acid

PDB Compounds: (B:) myo-inositol hexaphosphate phosphohydrolase

SCOP Domain Sequences for d2pt0b1:

Sequence; same for both SEQRES and ATOM records:

>d2pt0b1 c.45.1.4 (B:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]}
tvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvps
regmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerd
wanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaag
mryfriaatdhvwptpenidrflafyrtlpqdawlhfhceagvgrttafmvmtdmlknps
vslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqt
pwsvwlkshpaka

Timeline for d2pt0b1:

• d2pt0b1 is new in SCOP 1.75
  
• d2pt0b1 appears in SCOPe 2.01
  
• d2pt0b1 appears in the current release, SCOPe 2.08, called d2pt0b_