Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (1 protein) |
Protein Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117584] (1 species) |
Species Selenomonas ruminantium [TaxId:971] [117585] (8 PDB entries) Uniprot Q7WUJ1 34-346 |
Domain d2psza1: 2psz A:34-346 [149830] automatically matched to d1u24a_ complexed with gol |
PDB Entry: 2psz (more details), 2 Å
SCOP Domain Sequences for d2psza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2psza1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} tvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvps regmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerd wanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaag mryfriaatdhvwptpenidrflafyrtlpqdawlhfhceagvgrttafmvmtdmlknps vslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqt pwsvwlkshpaka
Timeline for d2psza1: