Lineage for d1dlya_ (1dly A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43954Family a.1.1.1: Truncated hemoglobin [46459] (1 protein)
  6. 43955Protein Truncated hemoglobin [46460] (3 species)
  7. 43958Species Green alga (Chlamydomonas eugametos) [TaxId:3054] [46462] (1 PDB entry)
  8. 43959Domain d1dlya_: 1dly A: [14983]

Details for d1dlya_

PDB Entry: 1dly (more details), 1.8 Å

PDB Description: x-ray crystal structure of hemoglobin from the green unicellular alga chlamydomonas eugametos

SCOP Domain Sequences for d1dlya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlya_ a.1.1.1 (A:) Truncated hemoglobin {Green alga (Chlamydomonas eugametos)}
slfaklggreaveaavdkfynkivadptvstyfsntdmkvqrskqfaflayalggasewk
gkdmrtahkdlvphlsdvhfqavarhlsdtltelgvppeditdamavvastrtevlnmpq
q

SCOP Domain Coordinates for d1dlya_:

Click to download the PDB-style file with coordinates for d1dlya_.
(The format of our PDB-style files is described here.)

Timeline for d1dlya_: