![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies) beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.100.2: MbtH-like [160582] (2 families) ![]() the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position |
![]() | Family d.100.2.1: MbtH-like [160583] (2 proteins) Pfam PF03621 |
![]() | Protein automated matches [190771] (1 species) not a true protein |
![]() | Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [187996] (1 PDB entry) |
![]() | Domain d2pstx_: 2pst X: [149829] automated match to d2gpfa1 |
PDB Entry: 2pst (more details), 1.8 Å
SCOPe Domain Sequences for d2pstx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pstx_ d.100.2.1 (X:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} ddiqfqvvvnheeqysiwpeykeipqgwraagksglkkdclayieevwtdmrplslrqhm d
Timeline for d2pstx_: