Lineage for d2pstx_ (2pst X:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967247Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2967311Superfamily d.100.2: MbtH-like [160582] (2 families) (S)
    the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position
  5. 2967312Family d.100.2.1: MbtH-like [160583] (2 proteins)
    Pfam PF03621
  6. 2967318Protein automated matches [190771] (1 species)
    not a true protein
  7. 2967319Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [187996] (1 PDB entry)
  8. 2967320Domain d2pstx_: 2pst X: [149829]
    automated match to d2gpfa1

Details for d2pstx_

PDB Entry: 2pst (more details), 1.8 Å

PDB Description: 1.8a crystal structure of the pa2412 protein from pseudomonas aeruginosa
PDB Compounds: (X:) Hypothetical protein PA2412

SCOPe Domain Sequences for d2pstx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pstx_ d.100.2.1 (X:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
ddiqfqvvvnheeqysiwpeykeipqgwraagksglkkdclayieevwtdmrplslrqhm
d

SCOPe Domain Coordinates for d2pstx_:

Click to download the PDB-style file with coordinates for d2pstx_.
(The format of our PDB-style files is described here.)

Timeline for d2pstx_: