SCOPe 2.07: Domain d2psmf_: 2psm F:

Lineage for d2psmf_ (2psm F:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Interleukin-15 receptor subunit alpha [161139] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [161140] (1 PDB entry)
   Uniprot Q60819 35-103

8. Domain d2psmf_: 2psm F: [149823]
   Other proteins in same PDB: d2psma1, d2psma2, d2psmb2, d2psmb3
   automated match to d2psmc1
   complexed with bam

Details for d2psmf_

PDB Entry: 2psm, 2.19 Å

PDB Description: crystal structure of interleukin 15 in complex with interleukin 15 receptor alpha

PDB Compounds: (F:) Interleukin-15 receptor alpha chain

SCOPe Domain Sequences for d2psmf_:

Sequence; same for both SEQRES and ATOM records:

>d2psmf_ g.18.1.1 (F:) Interleukin-15 receptor subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}
tcpppvsiehadirvknysvnsreryvcnsgfkrkagtstliecvinkntnvahwttpsl
kcirdpsl

Timeline for d2psmf_:

• d2psmf_ first appeared in SCOP 1.75, called d2psmf1
  
• d2psmf_ appears in SCOPe 2.06
  
• d2psmf_ appears in the current release, SCOPe 2.08