SCOP 1.75: Domain d2psmf1: 2psm F:3-70

Lineage for d2psmf1 (2psm F:3-70)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
   Pfam PF00084

6. Protein Interleukin-15 receptor subunit alpha [161139] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [161140] (1 PDB entry)
   Uniprot Q60819 35-103

8. Domain d2psmf1: 2psm F:3-70 [149823]
   Other proteins in same PDB: d2psma1, d2psmb1
   automatically matched to 2PSM C:3-71
   complexed with bam

Details for d2psmf1

PDB Entry: 2psm, 2.19 Å

PDB Description: crystal structure of interleukin 15 in complex with interleukin 15 receptor alpha

PDB Compounds: (F:) Interleukin-15 receptor alpha chain

SCOP Domain Sequences for d2psmf1:

Sequence; same for both SEQRES and ATOM records:

>d2psmf1 g.18.1.1 (F:3-70) Interleukin-15 receptor subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}
tcpppvsiehadirvknysvnsreryvcnsgfkrkagtstliecvinkntnvahwttpsl
kcirdpsl

Timeline for d2psmf1:

• d2psmf1 is new in SCOP 1.75
  
• d2psmf1 is called d2psmf_ in SCOPe 2.01
  
• d2psmf1 appears in the current release, SCOPe 2.08, called d2psmf_