Lineage for d2psmc1 (2psm C:3-71)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891351Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 891352Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 891353Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
    Pfam PF00084
  6. 891567Protein Interleukin-15 receptor subunit alpha [161139] (2 species)
  7. 891580Species Mouse (Mus musculus) [TaxId:10090] [161140] (1 PDB entry)
    Uniprot Q60819 35-103
  8. 891581Domain d2psmc1: 2psm C:3-71 [149822]
    Other proteins in same PDB: d2psma1, d2psmb1
    complexed with bam

Details for d2psmc1

PDB Entry: 2psm (more details), 2.19 Å

PDB Description: crystal structure of interleukin 15 in complex with interleukin 15 receptor alpha
PDB Compounds: (C:) Interleukin-15 receptor alpha chain

SCOP Domain Sequences for d2psmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2psmc1 g.18.1.1 (C:3-71) Interleukin-15 receptor subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}
tcpppvsiehadirvknysvnsreryvcnsgfkrkagtstliecvinkntnvahwttpsl
kcirdpsla

SCOP Domain Coordinates for d2psmc1:

Click to download the PDB-style file with coordinates for d2psmc1.
(The format of our PDB-style files is described here.)

Timeline for d2psmc1: