SCOP 1.75: Domain d2psmc1: 2psm C:3-71

Lineage for d2psmc1 (2psm C:3-71)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
   Pfam PF00084

6. Protein Interleukin-15 receptor subunit alpha [161139] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [161140] (1 PDB entry)
   Uniprot Q60819 35-103

8. Domain d2psmc1: 2psm C:3-71 [149822]
   Other proteins in same PDB: d2psma1, d2psmb1
   complexed with bam

Details for d2psmc1

PDB Entry: 2psm, 2.19 Å

PDB Description: crystal structure of interleukin 15 in complex with interleukin 15 receptor alpha

PDB Compounds: (C:) Interleukin-15 receptor alpha chain

SCOP Domain Sequences for d2psmc1:

Sequence; same for both SEQRES and ATOM records:

>d2psmc1 g.18.1.1 (C:3-71) Interleukin-15 receptor subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}
tcpppvsiehadirvknysvnsreryvcnsgfkrkagtstliecvinkntnvahwttpsl
kcirdpsla

Timeline for d2psmc1:

• d2psmc1 is new in SCOP 1.75
  
• d2psmc1 appears in SCOPe 2.01
  
• d2psmc1 appears in the current release, SCOPe 2.08