Lineage for d2psmb2 (2psm B:1-114)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318696Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2318697Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2318797Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2318840Protein Interleukin-15 (IL-15) [158422] (2 species)
  7. 2318853Species Mouse (Mus musculus) [TaxId:10090] [158424] (1 PDB entry)
    Uniprot P48346 49-162
  8. 2318855Domain d2psmb2: 2psm B:1-114 [149821]
    Other proteins in same PDB: d2psma2, d2psmb3, d2psmc1, d2psmf_
    automated match to d2psma1
    complexed with bam

Details for d2psmb2

PDB Entry: 2psm (more details), 2.19 Å

PDB Description: crystal structure of interleukin 15 in complex with interleukin 15 receptor alpha
PDB Compounds: (B:) Interleukin-15

SCOPe Domain Sequences for d2psmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2psmb2 a.26.1.2 (B:1-114) Interleukin-15 (IL-15) {Mouse (Mus musculus) [TaxId: 10090]}
nwidvrydlekiesliqsihidttlytdsdfhpsckvtamncfllelqvilheysnmtln
etvrnvlylanstlssnknvaesgckeceeleektfteflqsfirivqmfints

SCOPe Domain Coordinates for d2psmb2:

Click to download the PDB-style file with coordinates for d2psmb2.
(The format of our PDB-style files is described here.)

Timeline for d2psmb2: