SCOPe 2.01: Domain d2psmb_: 2psm B:

Lineage for d2psmb_ (2psm B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-15 (IL-15) [158422] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [158424] (1 PDB entry)
   Uniprot P48346 49-162

8. Domain d2psmb_: 2psm B: [149821]
   Other proteins in same PDB: d2psmc1, d2psmf_
   automated match to d2psma1
   complexed with bam

Details for d2psmb_

PDB Entry: 2psm, 2.19 Å

PDB Description: crystal structure of interleukin 15 in complex with interleukin 15 receptor alpha

PDB Compounds: (B:) Interleukin-15

SCOPe Domain Sequences for d2psmb_:

Sequence; same for both SEQRES and ATOM records:

>d2psmb_ a.26.1.2 (B:) Interleukin-15 (IL-15) {Mouse (Mus musculus) [TaxId: 10090]}
ssgnwidvrydlekiesliqsihidttlytdsdfhpsckvtamncfllelqvilheysnm
tlnetvrnvlylanstlssnknvaesgckeceeleektfteflqsfirivqmfints

Timeline for d2psmb_:

• d2psmb_ first appeared in SCOP 1.75, called d2psmb1
  
• d2psmb_ appears in SCOPe 2.02
  
• d2psmb_ appears in the current release, SCOPe 2.08, called d2psmb2