Lineage for d2psmb1 (2psm B:1-114)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767022Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 767023Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 767095Family a.26.1.2: Short-chain cytokines [47286] (13 proteins)
  6. 767119Protein Interleukin-15 (IL-15) [158422] (2 species)
  7. 767131Species Mouse (Mus musculus) [TaxId:10090] [158424] (1 PDB entry)
    Uniprot P48346 49-162
  8. 767133Domain d2psmb1: 2psm B:1-114 [149821]
    Other proteins in same PDB: d2psmc1, d2psmf1
    automatically matched to 2PSM A:1-114
    complexed with bam

Details for d2psmb1

PDB Entry: 2psm (more details), 2.19 Å

PDB Description: crystal structure of interleukin 15 in complex with interleukin 15 receptor alpha
PDB Compounds: (B:) Interleukin-15

SCOP Domain Sequences for d2psmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2psmb1 a.26.1.2 (B:1-114) Interleukin-15 (IL-15) {Mouse (Mus musculus) [TaxId: 10090]}
nwidvrydlekiesliqsihidttlytdsdfhpsckvtamncfllelqvilheysnmtln
etvrnvlylanstlssnknvaesgckeceeleektfteflqsfirivqmfints

SCOP Domain Coordinates for d2psmb1:

Click to download the PDB-style file with coordinates for d2psmb1.
(The format of our PDB-style files is described here.)

Timeline for d2psmb1: