![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein Interleukin-15 (IL-15) [158422] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [158424] (1 PDB entry) Uniprot P48346 49-162 |
![]() | Domain d2psma1: 2psm A:1-114 [149820] Other proteins in same PDB: d2psma2, d2psmb3, d2psmc1, d2psmf_ complexed with bam |
PDB Entry: 2psm (more details), 2.19 Å
SCOPe Domain Sequences for d2psma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2psma1 a.26.1.2 (A:1-114) Interleukin-15 (IL-15) {Mouse (Mus musculus) [TaxId: 10090]} nwidvrydlekiesliqsihidttlytdsdfhpsckvtamncfllelqvilheysnmtln etvrnvlylanstlssnknvaesgckeceeleektfteflqsfirivqmfints
Timeline for d2psma1:
![]() Domains from other chains: (mouse over for more information) d2psmb2, d2psmb3, d2psmc1, d2psmf_ |