Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1dlwa_ (1dlw A:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. Family a.1.1.1: Truncated hemoglobin [46459] (2 protein domains)
    lack the first helix (A)
  6. Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. Species Ciliate (Paramecium caudatum) [TaxId:5885] [46461] (2 PDB entries)
  8. Domain d1dlwa_: 1dlw A: [14982]
    complexed with hem

Details for d1dlwa_

PDB Entry: 1dlw (more details)
PDB Description: x-ray crystal structure of truncated hemoglobin from p.caudatum.
PDB Compounds: (A:) hemoglobin

SCOP Domain Sequences for d1dlwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]}
slfeqlggqaavqavtaqfyaniqadatvatffngidmpnqtnktaaflcaalggpnawt
grnlkevhanmgvsnaqfttvighlrsaltgagvaaalveqtvavaetvrgdvvtv

SCOP Domain Coordinates for d1dlwa_:

Click to download the PDB-style file with coordinates for d1dlwa_.
(The format of our PDB-style files is described here.)

Timeline for d1dlwa_:

d1dlwa_ appears in SCOP 1.75A


d1dlwa_
(click for larger image)


d1dlwa_ in context of chain

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu