![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.153: YerB-like [159773] (1 superfamily) 3 layers: b/b/a; central mixed beta-sheet of 9 strands, order 541329678; strands 3 and 7 are antiparallel to the rest; an unusual "over the other end" connection between strands 3 and 4 |
![]() | Superfamily c.153.1: YerB-like [159774] (1 family) ![]() automatically mapped to Pfam PF11258 |
![]() | Family c.153.1.1: YerB-like [159775] (1 protein) PfamB PB028118 |
![]() | Protein Uncharacterized protein YerB [159776] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [159777] (1 PDB entry) Uniprot O34968 32-327 |
![]() | Domain d2psba1: 2psb A:13-308 [149819] |
PDB Entry: 2psb (more details), 2.1 Å
SCOPe Domain Sequences for d2psba1:
Sequence, based on SEQRES records: (download)
>d2psba1 c.153.1.1 (A:13-308) Uncharacterized protein YerB {Bacillus subtilis [TaxId: 1423]} klkapltglkteqkvterrpvavvvnnhpkarpqsglskadiviealaegqitrflaifq sqmpetvgpvrsareyfvtlsngfdsifvhhgwspgakkqlesgaadymngldfdgslfw radfskpphnsytsydyikkaaeqkgyklkqetnpllfqtsdakpanesynvrvdygtnn vtnlveynydkkaefytrssdgvittdretgkpvamqnifiveashhiidqdgrrdidle sggkgllfqhgnvietdwkqvngrivpvkdgkwlpfvpgktwinivpdldaasisk
>d2psba1 c.153.1.1 (A:13-308) Uncharacterized protein YerB {Bacillus subtilis [TaxId: 1423]} klkapltglkteqkvterrpvavvvnnhpkarpqsglskadiviealaegqitrflaifq sqmpetvgpvrsareyfvtlsngfdsifvhhgwspgakkqlesgaadymngldfdgslfw radfskpphnsytsydyikkaaeqkgyklkqetnpllfqtnesynvrvdygtnnvtnlve ynydkkaefytrssdgvittdretgkpvamqnifiveashhiidqdgrrdidlesggkgl lfqhgnvietdwkqvngrivpvkdgkwlpfvpgktwinivpdldaasisk
Timeline for d2psba1: