Lineage for d2psba1 (2psb A:13-308)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2152177Fold c.153: YerB-like [159773] (1 superfamily)
    3 layers: b/b/a; central mixed beta-sheet of 9 strands, order 541329678; strands 3 and 7 are antiparallel to the rest; an unusual "over the other end" connection between strands 3 and 4
  4. 2152178Superfamily c.153.1: YerB-like [159774] (1 family) (S)
    automatically mapped to Pfam PF11258
  5. 2152179Family c.153.1.1: YerB-like [159775] (1 protein)
    PfamB PB028118
  6. 2152180Protein Uncharacterized protein YerB [159776] (1 species)
  7. 2152181Species Bacillus subtilis [TaxId:1423] [159777] (1 PDB entry)
    Uniprot O34968 32-327
  8. 2152182Domain d2psba1: 2psb A:13-308 [149819]

Details for d2psba1

PDB Entry: 2psb (more details), 2.1 Å

PDB Description: Crystal structure of YerB protein from Bacillus subtilis. NorthEast Structural Genomics target SR586
PDB Compounds: (A:) YerB protein

SCOPe Domain Sequences for d2psba1:

Sequence, based on SEQRES records: (download)

>d2psba1 c.153.1.1 (A:13-308) Uncharacterized protein YerB {Bacillus subtilis [TaxId: 1423]}
klkapltglkteqkvterrpvavvvnnhpkarpqsglskadiviealaegqitrflaifq
sqmpetvgpvrsareyfvtlsngfdsifvhhgwspgakkqlesgaadymngldfdgslfw
radfskpphnsytsydyikkaaeqkgyklkqetnpllfqtsdakpanesynvrvdygtnn
vtnlveynydkkaefytrssdgvittdretgkpvamqnifiveashhiidqdgrrdidle
sggkgllfqhgnvietdwkqvngrivpvkdgkwlpfvpgktwinivpdldaasisk

Sequence, based on observed residues (ATOM records): (download)

>d2psba1 c.153.1.1 (A:13-308) Uncharacterized protein YerB {Bacillus subtilis [TaxId: 1423]}
klkapltglkteqkvterrpvavvvnnhpkarpqsglskadiviealaegqitrflaifq
sqmpetvgpvrsareyfvtlsngfdsifvhhgwspgakkqlesgaadymngldfdgslfw
radfskpphnsytsydyikkaaeqkgyklkqetnpllfqtnesynvrvdygtnnvtnlve
ynydkkaefytrssdgvittdretgkpvamqnifiveashhiidqdgrrdidlesggkgl
lfqhgnvietdwkqvngrivpvkdgkwlpfvpgktwinivpdldaasisk

SCOPe Domain Coordinates for d2psba1:

Click to download the PDB-style file with coordinates for d2psba1.
(The format of our PDB-style files is described here.)

Timeline for d2psba1: