![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.369: SMI1/KNR4-like [160630] (1 superfamily) alpha(4)-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet, order 1234(meander) |
![]() | Superfamily d.369.1: SMI1/KNR4-like [160631] (1 family) ![]() |
![]() | Family d.369.1.1: SMI1/KNR4-like [160632] (3 proteins) Pfam PF09346 |
![]() | Protein Uncharacterized protein YobK [160637] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [160638] (1 PDB entry) Uniprot O34596 1-152 |
![]() | Domain d2prvb2: 2prv B:1-151 [149818] Other proteins in same PDB: d2prva2, d2prvb3 automated match to d2prva1 complexed with edo, so4 |
PDB Entry: 2prv (more details), 1.3 Å
SCOPe Domain Sequences for d2prvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2prvb2 d.369.1.1 (B:1-151) Uncharacterized protein YobK {Bacillus subtilis [TaxId: 1423]} miyskvenfinenkqnaiftegashenigrieenlqcdlpnsykwflekygagglfgvlv lgynfdhasvvnrtneykehygltdglvviedvdyfaycldtnkmkdgecpvvewdrvig yqdtvadsfieffynkiqeakddwdededwd
Timeline for d2prvb2: