Lineage for d2prub_ (2pru B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1489488Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1489489Protein Calcyclin (S100) [47479] (17 species)
  7. 1489635Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (7 PDB entries)
  8. 1489644Domain d2prub_: 2pru B: [149816]
    automated match to d2prua1

Details for d2prub_

PDB Entry: 2pru (more details)

PDB Description: nmr structure of human apos100b at 10c
PDB Compounds: (B:) Protein S100-B

SCOPe Domain Sequences for d2prub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2prub_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dndgdgecdfqefmafvamvttacheffehe

SCOPe Domain Coordinates for d2prub_:

Click to download the PDB-style file with coordinates for d2prub_.
(The format of our PDB-style files is described here.)

Timeline for d2prub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2prua_