SCOPe 2.03: Domain d2prua1: 2pru A:1-91

Lineage for d2prua1 (2pru A:1-91)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (6 PDB entries)

8. Domain d2prua1: 2pru A:1-91 [149815]
   automatically matched to d1mq1a_

Details for d2prua1

PDB Entry: 2pru

PDB Description: nmr structure of human apos100b at 10c

PDB Compounds: (A:) Protein S100-B

SCOPe Domain Sequences for d2prua1:

Sequence; same for both SEQRES and ATOM records:

>d2prua1 a.39.1.2 (A:1-91) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dndgdgecdfqefmafvamvttacheffehe

Timeline for d2prua1:

• d2prua1 first appeared in SCOP 1.75
  
• d2prua1 appears in SCOPe 2.02
  
• d2prua1 is called d2prua_ in SCOPe 2.04
  
• d2prua1 appears in the current release, SCOPe 2.08, called d2prua_