Lineage for d2prua1 (2pru A:1-91)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 914095Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 914096Protein Calcyclin (S100) [47479] (17 species)
  7. 914230Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (6 PDB entries)
  8. 914236Domain d2prua1: 2pru A:1-91 [149815]
    automatically matched to d1mq1a_

Details for d2prua1

PDB Entry: 2pru (more details)

PDB Description: nmr structure of human apos100b at 10c
PDB Compounds: (A:) Protein S100-B

SCOPe Domain Sequences for d2prua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2prua1 a.39.1.2 (A:1-91) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dndgdgecdfqefmafvamvttacheffehe

SCOPe Domain Coordinates for d2prua1:

Click to download the PDB-style file with coordinates for d2prua1.
(The format of our PDB-style files is described here.)

Timeline for d2prua1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2prub1