Lineage for d2prrb_ (2prr B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735103Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 2735104Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 2735160Family a.152.1.3: Atu0492-like [140970] (6 proteins)
    duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family
  6. 2735185Protein Uncharacterized protein Reut_A2532 [158825] (1 species)
  7. 2735186Species Ralstonia eutropha [TaxId:106590] [158826] (1 PDB entry)
    Uniprot Q46Y90 5-194
  8. 2735188Domain d2prrb_: 2prr B: [149804]
    automated match to d2prra1
    complexed with peg, pge

Details for d2prrb_

PDB Entry: 2prr (more details), 2.15 Å

PDB Description: crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution
PDB Compounds: (B:) Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein

SCOPe Domain Sequences for d2prrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2prrb_ a.152.1.3 (B:) Uncharacterized protein Reut_A2532 {Ralstonia eutropha [TaxId: 106590]}
ahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalmlk
dggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadipprqr
amldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrpnd
efflmgrvpk

SCOPe Domain Coordinates for d2prrb_:

Click to download the PDB-style file with coordinates for d2prrb_.
(The format of our PDB-style files is described here.)

Timeline for d2prrb_: