![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
![]() | Superfamily a.152.1: AhpD-like [69118] (4 families) ![]() probable biological unit contains six domains of this fold arranged with 32 symmetry |
![]() | Family a.152.1.3: Atu0492-like [140970] (6 proteins) duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family |
![]() | Protein Uncharacterized protein Reut_A2532 [158825] (1 species) |
![]() | Species Ralstonia eutropha [TaxId:106590] [158826] (1 PDB entry) Uniprot Q46Y90 5-194 |
![]() | Domain d2prra1: 2prr A:5-194 [149803] complexed with peg, pge |
PDB Entry: 2prr (more details), 2.15 Å
SCOPe Domain Sequences for d2prra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2prra1 a.152.1.3 (A:5-194) Uncharacterized protein Reut_A2532 {Ralstonia eutropha [TaxId: 106590]} ahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalmlk dggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadipprqr amldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrpnd efflmgrvpk
Timeline for d2prra1: