SCOP 1.75: Domain d2pqrb1: 2pqr B:5-128

Lineage for d2pqrb1 (2pqr B:5-128)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (8 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Mitochondria fission protein Fis1 [101417] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140836] (3 PDB entries)
   Uniprot P40515 1-138

8. Domain d2pqrb1: 2pqr B:5-128 [149793]
   automatically matched to d1y8ma1
   complexed with au

Details for d2pqrb1

PDB Entry: 2pqr, 1.88 Å

PDB Description: crystal structure of yeast fis1 complexed with a fragment of yeast caf4

PDB Compounds: (B:) Mitochondria fission 1 protein

SCOP Domain Sequences for d2pqrb1:

Sequence; same for both SEQRES and ATOM records:

>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dfwptlkdayeplypqqleilrqqvvseggptatiqsrfnyawglikstdvnderlgvki
ltdiykeaesrrreclyyltigcyklgeysmakryvdtlfehernnkqvgalksmvedki
qket

Timeline for d2pqrb1:

• d2pqrb1 is new in SCOP 1.75
  
• d2pqrb1 is called d2pqrb_ in SCOPe 2.01
  
• d2pqrb1 appears in the current release, SCOPe 2.08, called d2pqrb_