| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
| Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
| Protein Mitochondria fission protein Fis1 [101417] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140836] (3 PDB entries) Uniprot P40515 1-138 |
| Domain d2pqrb_: 2pqr B: [149793] automated match to d1y8ma1 complexed with au |
PDB Entry: 2pqr (more details), 1.88 Å
SCOPe Domain Sequences for d2pqrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pqrb_ a.118.8.1 (B:) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dfwptlkdayeplypqqleilrqqvvseggptatiqsrfnyawglikstdvnderlgvki
ltdiykeaesrrreclyyltigcyklgeysmakryvdtlfehernnkqvgalksmvedki
qket
Timeline for d2pqrb_: