SCOPe 2.06: Domain d2pqad_: 2pqa D:

Lineage for d2pqad_ (2pqa D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein automated matches [190206] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186959] (26 PDB entries)

8. Domain d2pqad_: 2pqa D: [149791]
   Other proteins in same PDB: d2pqaa_, d2pqac_
   automated match to d3kdfc_

Details for d2pqad_

PDB Entry: 2pqa, 2.5 Å

PDB Description: Crystal Structure of Full-length Human RPA 14/32 Heterodimer

PDB Compounds: (D:) Replication protein A 14 kDa subunit

SCOPe Domain Sequences for d2pqad_:

Sequence; same for both SEQRES and ATOM records:

>d2pqad_ b.40.4.3 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepldeei
sgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgi

Timeline for d2pqad_:

• d2pqad_ first appeared in SCOP 1.75, called d2pqad1
  
• d2pqad_ appears in SCOPe 2.05
  
• d2pqad_ appears in SCOPe 2.07
  
• d2pqad_ appears in the current release, SCOPe 2.08