Lineage for d2pq7a1 (2pq7 A:1-217)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736617Family a.211.1.1: HD domain [101340] (15 proteins)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2736669Protein Predicted hydrolase mes0020 [158719] (1 species)
  7. 2736670Species Uncultured thermotogales bacterium [TaxId:221214] [158720] (1 PDB entry)
    Uniprot Q1EM40 1-217
  8. 2736671Domain d2pq7a1: 2pq7 A:1-217 [149786]
    complexed with cl, fe, mpd, po4

Details for d2pq7a1

PDB Entry: 2pq7 (more details), 1.45 Å

PDB Description: crystal structure of predicted hd superfamily hydrolase (104161995) from uncultured thermotogales bacterium at 1.45 a resolution
PDB Compounds: (A:) Predicted HD superfamily hydrolase

SCOPe Domain Sequences for d2pq7a1:

Sequence, based on SEQRES records: (download)

>d2pq7a1 a.211.1.1 (A:1-217) Predicted hydrolase mes0020 {Uncultured thermotogales bacterium [TaxId: 221214]}
mnltelmeriphlreilnivreafkdyddpahdishtfrvmenaseiasrekcdlqkaii
aallhdikrphealtgvdhaesgaeyasgllptmgfdisfvaevskairshrysggltpt
sltgkilqdadrldaigavaiarvfsysgktgtplhslqfsprssysgnsrssinhfhek
ilkirpetfwtetarkmaedrysfvvefvqrflaewg

Sequence, based on observed residues (ATOM records): (download)

>d2pq7a1 a.211.1.1 (A:1-217) Predicted hydrolase mes0020 {Uncultured thermotogales bacterium [TaxId: 221214]}
mnltelmeriphlreilnivreafkdyddpahdishtfrvmenaseiasrekcdlqkaii
aallhdikrphealtgvdhaesgaeyasgllptmgfdisfvaevskairshrtptsltgk
ilqdadrldaigavaiarvfsypetfwtetarkmaedrysfvvefvqrflaewg

SCOPe Domain Coordinates for d2pq7a1:

Click to download the PDB-style file with coordinates for d2pq7a1.
(The format of our PDB-style files is described here.)

Timeline for d2pq7a1: