Lineage for d2pq6a1 (2pq6 A:8-480)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142483Family c.87.1.10: UDPGT-like [159785] (5 protein domains)
    Pfam PF00201
  6. 2142484Protein (Iso)flavonoid glycosyltransferase [159790] (1 species)
  7. 2142485Species Medicago truncatula [TaxId:3880] [159791] (1 PDB entry)
    Uniprot A6XNC5 8-480
  8. 2142486Domain d2pq6a1: 2pq6 A:8-480 [149785]

Details for d2pq6a1

PDB Entry: 2pq6 (more details), 2.1 Å

PDB Description: Crystal structure of Medicago truncatula UGT85H2- Insights into the structural basis of a multifunctional (Iso) flavonoid glycosyltransferase
PDB Compounds: (A:) UDP-glucuronosyl/UDP-glucosyltransferase

SCOPe Domain Sequences for d2pq6a1:

Sequence, based on SEQRES records: (download)

>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]}
kphvvmipypvqghinplfklakllhlrgfhitfvnteynhkrllksrgpkafdgftdfn
fesipdgltpmegdgdvsqdvptlcqsvrknflkpycelltrlnhstnvppvtclvsdcc
msftiqaaeefelpnvlyfsssacsllnvmhfrsfvergiipfkdesyltngcletkvdw
ipglknfrlkdivdfirttnpndimleffievadrvnkdttillntfnelesdvinalss
tipsiypigplpsllkqtpqihqldsldsnlwkedtecldwleskepgsvvyvnfgsttv
mtpeqllefawglanckksflwiirpdlviggsvifsseftneiadrgliaswcpqdkvl
nhpsiggflthcgwnsttesicagvpmlcwpffadqptdcrficneweigmeidtnvkre
elaklineviagdkgkkmkqkamelkkkaeentrpggcsymnlnkvikdvllk

Sequence, based on observed residues (ATOM records): (download)

>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]}
kphvvmipypvqghinplfklakllhlrgfhitfvnteynhkrlldfnfesipdgltqdv
ptlcqsvrknflkpycelltrlnhstnvppvtclvsdccmsftiqaaeefelpnvlyfss
sacsllnvmhfrsfvergiipfkdesyltngcletkvdwipglknfrlkdivdfirttnp
ndimleffievadrvnkdttillntfnelesdvinalsstipsiypigplpsllkqtpqi
hqldstecldwleskepgsvvyvnfgsttvmtpeqllefawglanckksflwiirpdlvi
ggsvifsseftneiadrgliaswcpqdkvlnhpsiggflthcgwnsttesicagvpmlcw
pffadqptdcrficneweigmeidtnvkreelaklineviagdkgkkmkqkamelkkkae
entrpggcsymnlnkvikdvllk

SCOPe Domain Coordinates for d2pq6a1:

Click to download the PDB-style file with coordinates for d2pq6a1.
(The format of our PDB-style files is described here.)

Timeline for d2pq6a1: