SCOPe 2.08: Domain d2pq3a_: 2pq3 A:

Lineage for d2pq3a_ (2pq3 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (13 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [158477] (19 PDB entries)

8. Domain d2pq3a_: 2pq3 A: [149784]
   automated match to d1j7oa_
   complexed with cac, zn
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2pq3a_

PDB Entry: 2pq3, 1.3 Å

PDB Description: N-Terminal Calmodulin Zn-Trapped Intermediate

PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d2pq3a_:

Sequence; same for both SEQRES and ATOM records:

>d2pq3a_ a.39.1.5 (A:) Calmodulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmarkm

Timeline for d2pq3a_:

• d2pq3a_ first appeared in SCOP 1.75, called d2pq3a1
  
• d2pq3a_ appears in SCOPe 2.07