Lineage for d2ppqa1 (2ppq A:5-320)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586169Family d.144.1.6: APH phosphotransferases [64411] (5 proteins)
  6. 2586174Protein Homoserine kinase ThrB [160816] (1 species)
  7. 2586175Species Agrobacterium tumefaciens [TaxId:358] [160817] (1 PDB entry)
    Uniprot Q8UHA8 5-320
  8. 2586176Domain d2ppqa1: 2ppq A:5-320 [149782]
    complexed with mg, po4

Details for d2ppqa1

PDB Entry: 2ppq (more details), 2 Å

PDB Description: Crystal structure of the homoserine kinase from Agrobacterium tumefaciens
PDB Compounds: (A:) homoserine kinase

SCOPe Domain Sequences for d2ppqa1:

Sequence, based on SEQRES records: (download)

>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]}
tditedelrnfltqydvgsltsykgiaegvensnfllhttkdpliltlyekrvekndlpf
flglmqhlaakglscplplprkdgellgelsgrpaalisflegmwlrkpeakhcrevgka
laamhlasegfeikrpnalsvdgwkvlwdkseeradevekglreeirpeidylaahwpkd
lpagvihadlfqdnvfflgdelsglidfyfacndllaydvsiclnawcfekdgaynvtkg
kallegyqsvrplseaelealpllsrgsalrffltrlydwlttpagalvvkkdpleylrk
lrfhrtianvaeygla

Sequence, based on observed residues (ATOM records): (download)

>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]}
tditedelrnfltqydvgsltsykgiaensnfllhttkdpliltlyekkndlpfflglmq
hlaakglscplplprkdgellgelsgrpaalisflegmwlrkpeakhcrevgkalaamhl
asegfeikrpnalsvdgwkvlwdkseeradevekglreeirpeidylaahwpkdlpagvi
hadlfqdnvfflgdelsglidfyfacndllaydvsiclnawcfekdgaynvtkgkalleg
yqsvrplseaelealpllsrgsalrffltrlydwlttpagalvvkkdpleylrklrfhrt
ianvaeygla

SCOPe Domain Coordinates for d2ppqa1:

Click to download the PDB-style file with coordinates for d2ppqa1.
(The format of our PDB-style files is described here.)

Timeline for d2ppqa1: