SCOP 1.75: Domain d2ppfc1: 2ppf C:12-164

Lineage for d2ppfc1 (2ppf C:12-164)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (33 PDB entries)
   Uniprot P38501

8. Domain d2ppfc1: 2ppf C:12-164 [149779]
   automatically matched to d1ndra1
   complexed with act, cu, cu1, no, trs; mutant

Details for d2ppfc1

PDB Entry: 2ppf, 1.65 Å

PDB Description: reduced mutant d98n of afnir exposed to nitric oxide

PDB Compounds: (C:) Copper-containing nitrite reductase

SCOP Domain Sequences for d2ppfc1:

Sequence; same for both SEQRES and ATOM records:

>d2ppfc1 b.6.1.3 (C:12-164) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
lprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtvpgp
lmvvhqddyleltlinpetntlmhninfhaatgalgggglteinpgektilrfkatkpgv
fvyhcappgmvpwhvvsgmngaimvlpreglhd

Timeline for d2ppfc1:

• d2ppfc1 is new in SCOP 1.75
  
• d2ppfc1 appears in SCOPe 2.01
  
• d2ppfc1 appears in the current release, SCOPe 2.08