Class b: All beta proteins [48724] (174 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (37 PDB entries) Uniprot P38501 |
Domain d2ppea1: 2ppe A:4-166 [149769] automated match to d1npna1 complexed with act, cu, cu1, no, trs; mutant |
PDB Entry: 2ppe (more details), 1.75 Å
SCOPe Domain Sequences for d2ppea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ppea1 b.6.1.3 (A:4-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]} ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr fkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgk
Timeline for d2ppea1:
View in 3D Domains from other chains: (mouse over for more information) d2ppeb1, d2ppeb2, d2ppec1, d2ppec2 |