| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
| Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
| Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419326] (31 PDB entries) Uniprot P38501 |
| Domain d2ppcc1: 2ppc C:4-166 [149761] Other proteins in same PDB: d2ppca2, d2ppcb2, d2ppcc2 automated match to d1snra1 complexed with act, cu, cu1, no2, trs |
PDB Entry: 2ppc (more details), 1.58 Å
SCOPe Domain Sequences for d2ppcc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ppcc1 b.6.1.3 (C:4-166) Nitrite reductase, NIR, N-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk
Timeline for d2ppcc1:
View in 3DDomains from other chains: (mouse over for more information) d2ppca1, d2ppca2, d2ppcb1, d2ppcb2 |