Lineage for d2ppbd_ (2ppb D:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574346Family e.29.1.2: RNA-polymerase beta-prime [64490] (4 proteins)
  6. 2574414Protein automated matches [254473] (5 species)
    not a true protein
  7. 2574422Species Thermus thermophilus HB8 [TaxId:300852] [255520] (3 PDB entries)
  8. 2574425Domain d2ppbd_: 2ppb D: [149754]
    Other proteins in same PDB: d2ppbc_, d2ppbe_, d2ppbm_, d2ppbo_
    automated match to d4g7od_
    protein/DNA complex; protein/RNA complex; complexed with apc, mg, std, zn

Details for d2ppbd_

PDB Entry: 2ppb (more details), 3 Å

PDB Description: Crystal structure of the T. thermophilus RNAP polymerase elongation complex with the ntp substrate analog and antibiotic streptolydigin
PDB Compounds: (D:) DNA-directed RNA polymerase beta' chain

SCOPe Domain Sequences for d2ppbd_:

Sequence, based on SEQRES records: (download)

>d2ppbd_ e.29.1.2 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
laelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivekg
qplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegarv
eagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdvl
adggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleem
khpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdln
dlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplr
sltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkm
eekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlv
egqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakp
srdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlky
vfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliq
ldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekk
qyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnply
vmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkgg
adtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradie
aglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvc
qkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvie
lfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyvea
gqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvev
tdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfq
ntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieearke
avea

Sequence, based on observed residues (ATOM records): (download)

>d2ppbd_ e.29.1.2 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
geevvkgqelapgvvsrldgvalyrfasilvvkarvypfeddvevstgdrvapgdvladg
gkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleemkhp
srarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlndly
rrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplrslt
dilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkmeek
giapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlvegq
siqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakpsrd
iilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlkyvfa
npdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliqldv
pqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekkqyl
eeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnplyvma
qsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkggadt
alrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradieagl
ygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvcqkc
ygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtditqglprvielfearrpkak
aviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyveagqpltrgaid
phqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvevtdpgdsrlle
gqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfqntthvlteaa
iagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieearkeavea

SCOPe Domain Coordinates for d2ppbd_:

Click to download the PDB-style file with coordinates for d2ppbd_.
(The format of our PDB-style files is described here.)

Timeline for d2ppbd_: