Lineage for d2ppab1 (2ppa B:12-164)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 940170Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 940171Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 940701Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 940824Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 940862Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (33 PDB entries)
    Uniprot P38501
  8. 940949Domain d2ppab1: 2ppa B:12-164 [149749]
    automatically matched to d1ndra1
    complexed with act, cu, cu1, n2o, trs

Details for d2ppab1

PDB Entry: 2ppa (more details), 1.69 Å

PDB Description: Anaerobically manipulated wild type oxidized AfNiR bound to nitrous oxide
PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2ppab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ppab1 b.6.1.3 (B:12-164) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
lprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtvpgp
lmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfkatkpgv
fvyhcappgmvpwhvvsgmngaimvlpreglhd

SCOPe Domain Coordinates for d2ppab1:

Click to download the PDB-style file with coordinates for d2ppab1.
(The format of our PDB-style files is described here.)

Timeline for d2ppab1: