![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
![]() | Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
![]() | Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (33 PDB entries) Uniprot P38501 |
![]() | Domain d2ppab1: 2ppa B:12-164 [149749] automatically matched to d1ndra1 complexed with act, cu, cu1, n2o, trs |
PDB Entry: 2ppa (more details), 1.69 Å
SCOP Domain Sequences for d2ppab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ppab1 b.6.1.3 (B:12-164) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]} lprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtvpgp lmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfkatkpgv fvyhcappgmvpwhvvsgmngaimvlpreglhd
Timeline for d2ppab1:
![]() Domains from other chains: (mouse over for more information) d2ppaa1, d2ppaa2, d2ppac1, d2ppac2 |