| Class b: All beta proteins [48724] (174 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
| Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
| Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (33 PDB entries) Uniprot P38501 |
| Domain d2ppaa2: 2ppa A:167-337 [149748] automatically matched to d1ndra2 complexed with act, cu, cu1, n2o, trs |
PDB Entry: 2ppa (more details), 1.69 Å
SCOPe Domain Sequences for d2ppaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ppaa2 b.6.1.3 (A:167-337) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlap
Timeline for d2ppaa2:
View in 3DDomains from other chains: (mouse over for more information) d2ppab1, d2ppab2, d2ppac1, d2ppac2 |